Molecular Profile
What Is LL-37?
A 37-residue cationic, amphipathic alpha-helical peptide released by proteolytic cleavage from the C-terminus of the 18-kDa human cathelicidin protein hCAP-18. It is the only cathelicidin-derived antimicrobial peptide found in humans and is expressed by neutrophils and epithelial cells. The name comes from its two N-terminal leucines and its length (37 residues).
Host-Defense PeptideImmune / Wound Research
- Type
- Cationic host-defense (antimicrobial) peptide
- CAS Number
- 154947-66-7
- Molecular Weight
- ~4493 g/mol (C205H340N60O53)
- Amino Acids
- 37
- Sequence
- [LL-37, 37 aa]
- Parent protein
- hCAP-18 (human cathelicidin, CAMP gene)
